PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI11G05160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 264aa    MW: 28397.6 Da    PI: 10.4996
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI11G05160.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-172671147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  OMERI11G05160.1 26 RGHWRPGEDEKLRQLVEKYGPQNWNSIAEKLE-GRSGKSCRLRWFNQ 71
                     899*****************************.***********996 PP

2Myb_DNA-binding62.58.5e-2079122247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T+eE+e+l+ a++ +G++ W++Iar+++ gRt++ +k++w+ +
  OMERI11G05160.1  79 RPFTEEEEERLLAAHRHHGNK-WALIARHFP-GRTDNAVKNHWHVV 122
                      69*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.6622172IPR017930Myb domain
SuperFamilySSF466893.59E-3025119IPR009057Homeodomain-like
SMARTSM007172.1E-142574IPR001005SANT/Myb domain
PfamPF002497.9E-172671IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-272779IPR009057Homeodomain-like
CDDcd001672.06E-142970No hitNo description
PROSITE profilePS5129428.91873127IPR017930Myb domain
SMARTSM007171.3E-1677125IPR001005SANT/Myb domain
PfamPF002497.6E-1778121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-2280122IPR009057Homeodomain-like
CDDcd001671.05E-889120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MASSSTTNTS DGAGKPASSS SSACPRGHWR PGEDEKLRQL VEKYGPQNWN SIAEKLEGRS  60
GKSCRLRWFN QLDPRINKRP FTEEEEERLL AAHRHHGNKW ALIARHFPGR TDNAVKNHWH  120
VVRARRSRER SRLLARATAA AHPPPLSSYV AASQLDFGGG GGGAARNSSL CFGFGINRSS  180
SSSPAAPFLI KSFNGASYGT LLPATTTMAA AAQPVSTITF SSTPMRETLE LMDAGGHDNH  240
GGGDVDGGDK RKGVPFFDFL GVGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-3026119497C-Myb DNA-Binding Domain
1msf_C2e-3026119497C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1235230.0AC123523.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0051P13, complete sequence.
GenBankAF1722820.0AF172282.1 Oryza sativa adh1-adh2 region.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615875.11e-142PREDICTED: transcription factor MYB44
TrEMBLA0A0E0F3E60.0A0A0E0F3E6_9ORYZ; Uncharacterized protein
STRINGBGIOSGA034994-PA1e-142(Oryza sativa Indica Group)
STRINGLOC_Os11g10130.11e-142(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-49myb domain protein 52